PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10000976m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 485aa    MW: 53502.3 Da    PI: 7.4054
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10000976mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.41.6e-24141242199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd+++ g +++p++ ae++       +  ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + 
  Ciclev10000976m 141 FCKTLTASDTSTYGGFSVPRRAAEDCfppldymQ--QRPSQQLVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RG 230
                      99*****************************743..345568************************************************..44 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      +++el+++++r+
  Ciclev10000976m 231 EDGELKIGIRRA 242
                      99*******996 PP

2Auxin_resp116.62.1e-38267348182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +++a++ k +F++ YnPras+seFv++v+k++k+++++++ GmRfkm+ eted++err+sG++vgvsd+dpvrWp+SkWr+L
  Ciclev10000976m 267 VVDAIARKRAFSISYNPRASASEFVIPVNKFLKSIDHPFAEGMRFKMRSETEDAAERRCSGMIVGVSDTDPVRWPGSKWRCL 348
                      578999***************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-39132244IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-42134257IPR015300DNA-binding pseudobarrel domain
CDDcd100176.56E-23139241No hitNo description
PfamPF023622.3E-22141242IPR003340B3 DNA binding domain
SMARTSM010195.2E-22141243IPR003340B3 DNA binding domain
PROSITE profilePS5086313.352141243IPR003340B3 DNA binding domain
PfamPF065073.7E-33268348IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MVGLIDLNKT KDDENPSSGS LASASASASG VSSELWHACA GPLIFLPKRG SVVVYFPQGH  60
LEHVSDFSAA ASTAYDLPPH LFCRVADVKL HADAASDEVY AQVSLVHDEL IEQKVRKGKI  120
KEDGDEESVE VAAKSSTTHM FCKTLTASDT STYGGFSVPR RAAEDCFPPL DYMQQRPSQQ  180
LVAKDLHGVE WKFRHIYRGQ PRRHLLTTGW SAFVNKKKLV SGDAVLFLRG EDGELKIGIR  240
RAAQVKNGAT FPSFCNQHSS TSSVTEVVDA IARKRAFSIS YNPRASASEF VIPVNKFLKS  300
IDHPFAEGMR FKMRSETEDA AERRCSGMIV GVSDTDPVRW PGSKWRCLLV RWDDVESNRH  360
NRVSPWEIEP SGSNILVTSG LRRTRIGLPL WRPEFPVPEG IGVTDFGESL RFQTVLQGQE  420
ISPKSPYGRA PTNNEAHDIG SLGISDGLQE VWTREHMYLS DAEATKMRVN DGVTVLEGRG  480
CARR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1073137351392Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015383553.10.0PREDICTED: auxin response factor 3-like isoform X6
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A067F6V90.0A0A067F6V9_CITSI; Auxin response factor
STRINGVIT_10s0003g00420.t010.0(Vitis vinifera)
STRINGGLYMA07G32300.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein